PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn137671
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 331aa    MW: 36983 Da    PI: 9.8898
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn137671genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.24.6e-14120164347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + ++ G+g+W+ I++ + k+Rt+ q+ s+ qky
       Achn137671 120 PWTEEEHKLFLLGLQKVGKGDWRGISKNFVKTRTPTQVASHAQKY 164
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.985113169IPR017930Myb domain
SuperFamilySSF466893.44E-17115170IPR009057Homeodomain-like
TIGRFAMsTIGR015577.3E-17116167IPR006447Myb domain, plants
SMARTSM007171.4E-10117167IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-11119164IPR009057Homeodomain-like
PfamPF002499.2E-12120164IPR001005SANT/Myb domain
CDDcd001671.44E-9120165No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MLVAQGLFSN NRPSFSAPTK RSFSLYKYHL NPLDRFSIRP PNDRFTKMSH SADCAVAEIM  60
LFGVRVKVDP MRKSVSMNDL SQYEQPHESS IAAVGGGYAS VDDAIHLQSS GSRERKRGVP  120
WTEEEHKLFL LGLQKVGKGD WRGISKNFVK TRTPTQVASH AQKYFLRRNS INRRRRRSSL  180
FDITTESVTA ILMEEETVHQ DTKTQPLLPP TQLLPPESTN ISGSQVLPFQ VSVRPVLIPV  240
QIENPMEQLT LGHLDQGNPE PTKLLWPAHF LPIPNASAAM DVNLNQKSVV DPSQLSLKLS  300
LSSDQNQLSR YSSFQVMSSF NNEDSIISVA *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012080161.12e-92PREDICTED: transcription factor MYB1R1
SwissprotQ2V9B06e-86MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLF8SPH02e-99F8SPH0_CAMSI; MYB transcription factor 1
STRINGSolyc06g071230.2.18e-84(Solanum lycopersicum)
STRINGPGSC0003DMT4000830328e-84(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25742351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19000.22e-54MYB_related family protein